SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336253242|ref|YP_004596349.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253242|ref|YP_004596349.1|
Domain Number 1 Region: 32-88,251-453
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.98e-45
Family Bacterial dinuclear zinc exopeptidases 0.015
Further Details:      
 
Domain Number 2 Region: 128-207
Classification Level Classification E-value
Superfamily PA domain 0.000000000562
Family PA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336253242|ref|YP_004596349.1|
Sequence length 488
Comment peptidase M28 [Halopiger xanaduensis SH-6]
Sequence
MDGADDSDGDQGTDRDRNRDRDARDATLERALGRAWTDDRAWDLLTRLTELPHRMGGSEG
ERRAAEIVRETFSAVGLEDVRLEKFPMQQWDRRKTEFTVLGGDPATGDQHNAAPSDSDAT
DAGRVERSFEAIALPYSPPAEVEGPLVDVGSGTPEEIADADLRGAVAVASTTTPEGQRFV
HRMEKFGHAVDAGAEAFVFANHVPGQLPPTGALKFNAEAAVPGIGVSAETGDWLSEYAER
GTRARIRVDAQTREGSSQNVHGRLGPETDEEVVVVAHYDAHDITEGALDNGCGIATVAAA
SGILADVEEDLERTVRIVGVGCEEIGLLGSEALADQLDLESVRAVVNVDGAGRFRNLRAL
AHGSEPLAELAEEIASEAGQPVSREPDPHPFSDHWPFLRAGVPSLQLHSEPPEGRERGRG
WGHTTADTRDKADPRNLREHAMLTALLVRELTDQSVPRIDEEELRERLREREYEPGMRAA
EIWPPTWA
Download sequence
Identical sequences F8D5P8
gi|336253242|ref|YP_004596349.1| WP_013879363.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]