SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336253315|ref|YP_004596422.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253315|ref|YP_004596422.1|
Domain Number 1 Region: 52-347
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.14e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 348-545
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.22e-34
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336253315|ref|YP_004596422.1|
Sequence length 750
Comment 5'-Nucleotidase domain-containing protein [Halopiger xanaduensis SH-6]
Sequence
MARESASRTRDRTNDDVDRSRRRFLGAAAGASAATLLPATDRARAASTTTTDGTVTLVHD
THFHGRFNDASADELSLARYYSVVEDVLADADNGLFVGNGDDFAPSMLGLEYEGEHMVEA
LNYTDLAVDGVGNHEFDFGADVATTRFEESEFPWVVANLLDDAGDPVPGTERWTTLEAGG
LTVGVFGLVSENFHSLTDYPEEWQVLEYVEASQEAVDSLRDAGADVVVCASHVSTGVHET
LAESVDGLDAIVGSHSGVVFDEPEVVDGTVISEFGDEFDHVGAITLDAEGELADWRRTDL
LLPDSDPAPAVEEYDQISVRYTDEIEPDERLAELADEWLGDLEERLGQPAFESEVELDAT
YNNYAIETNWGNLMTDAMRAVGEIGDVEVDIAANNAGGIRSDSTYGPGEITGTDVMDILP
FPNEILVVEATGQQVIDYLEEALRPHPAPDFGAQPAIQVSGVSYEWTGHEDDAGVENVFV
GDDPIDPEATYTFAHNDYSIGNSEVLSEAEVVLESGQFQGPFVLEQLEQRDTVAPERENR
MIRVDETVDAASISRNAEELTLTAPVPEGAAEVATEPGAYRVVVRTGDDLEATSVTADGD
AVNVTFDAASLTDLAESIDDPALRLFGGYSPDQDYWGYDYEVPNSSGYDRFRFKAPVDAA
AVLEGAQDGTGDENADSVADDGNAGSGGDGDGDDNGSEGESGDGSDDSVPGFGPIAAVTG
GSAGAYLYARGRGNDAGADASDESANSTDD
Download sequence
Identical sequences F8D6F6
gi|336253315|ref|YP_004596422.1| WP_013879436.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]