SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336253500|ref|YP_004596607.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336253500|ref|YP_004596607.1|
Domain Number 1 Region: 241-492
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.35e-61
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 9-192
Classification Level Classification E-value
Superfamily Globin-like 0.0000000059
Family Globins 0.037
Further Details:      
 
Weak hits

Sequence:  gi|336253500|ref|YP_004596607.1|
Domain Number - Region: 151-243
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00746
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336253500|ref|YP_004596607.1|
Sequence length 499
Comment methyl-accepting chemotaxis sensory transducer [Halopiger xanaduensis SH-6]
Sequence
MSQQGQAMGDAGAPQRTSFDRASVDRVKEFVGFGPEDERRLESQAHLFERVSDDLADEYY
ENVRSRRKLDEAFAASALSEAEFKREHRQYLEAFGEGDYGPAFFERRAEFSPADLFVEPG
LNEYVGSYMVYYEQLLEEIADEVTAEYAPDPGAEATGDEPDAAAAVEDAVDETVERTLST
LRLAVLDQQFVIGSKVDDFMEQLASMTQRRESVRADLEDTVEELEDYAERIGDGTETIDD
VATEQSSSTAEIASEMSNLSATVEEIASNTEEVSATAERAEEIAGETTDTAERAIDKMEG
VQDAAGEVTEDVEDLREGVQRIDEIVDVINDIADQTNLLALNASIEAATAGEAGDGFAVV
ADEVKNLAEESQEEAATIERMVNQIQEDTQETVESLEDANAEIDDGVELVEDTVENLGEI
ETAVSEAASGVDEVATATDDQAASTEEIAGMADEVMENADQVAAEVESLAEVSEDVERQV
QVVTEMVDRLADVQENGDV
Download sequence
Identical sequences F8D7Z1
WP_013879621.1.76661 gi|336253500|ref|YP_004596607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]