SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336254671|ref|YP_004597778.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|336254671|ref|YP_004597778.1|
Domain Number - Region: 29-90
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0159
Family Diacylglycerol kinase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336254671|ref|YP_004597778.1|
Sequence length 138
Comment hypothetical protein Halxa_3287 [Halopiger xanaduensis SH-6]
Sequence
MKITHQEVEFDEFSRVCDLVEEYFGETLDDVALHAPVSRRQLVAVLARAQLSGRRLANDG
DGLADAGDVVYQSNRETLYWLDGDFWTDVCGRHHLEPDEGRAAREVHRRILEAIDGDVSH
YNRERDPFVLIERFGLYE
Download sequence
Identical sequences F8D807
gi|336254671|ref|YP_004597778.1| WP_013880789.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]