SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336252613|ref|YP_004595720.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336252613|ref|YP_004595720.1|
Domain Number 1 Region: 156-337
Classification Level Classification E-value
Superfamily SGNH hydrolase 8.86e-22
Family BT2961-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336252613|ref|YP_004595720.1|
Sequence length 340
Comment G-D-S-L family lipolytic protein [Halopiger xanaduensis SH-6]
Sequence
MIGDHYPSVSLHNVAELAAPEWTADGDQLCRVPASVGAKLNVSARERVRGPTNSELRFVP
DGDDVEIEITLSAADRTRVWPFWGEFRPWEPFEIGPEPETHAFSVPERLARLEADAGADA
GRFDPRVCRLRFERAPSVALHGVSGDCRPPTADELPERRYLAYGTSITEGAASSAPHLNY
VSHVARGIDADVLNFGCSGSAYCEPAMADYLASRDDWDVATLALSVNMANRGFTVEQFRE
RADYFVNRIAAAHPEKPIACVTLFPYFADVIEGGDAQRAADFRAALREVVADSSHDTLSL
VEGAELMELTGLAADLLHPGDTGMEAIGEGLAAHLESRLE
Download sequence
Identical sequences F8DAN2
WP_013878740.1.76661 gi|336252613|ref|YP_004595720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]