SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336254643|ref|YP_004597750.1| from Halopiger xanaduensis SH-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336254643|ref|YP_004597750.1|
Domain Number 1 Region: 71-311
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.69e-51
Family EF1021-like 0.0027
Further Details:      
 
Domain Number 2 Region: 312-427
Classification Level Classification E-value
Superfamily SCP-like 9.81e-22
Family EF1021 C-terminal domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336254643|ref|YP_004597750.1|
Sequence length 427
Comment acetyltransferase [Halopiger xanaduensis SH-6]
Sequence
MVDYRPIPDRRKLFHEYRMYAFAPEQGPPAYDPEEHDTPRALLGNPRGVFADGDDERDER
GTIDGDGTDADPRCVCRHYWLEARVRGELHPTAGLAAVATPPEHRRGGYVGTMLERSLEE
YRDRGDRFAVLWPFEYAFYRQFGWDTSNRVAFHECEPGELSFATAAIDGEGSFYSVDPDE
YDVLDPAYERYAERYALALERDREWWRCRLFENHDTDPFVYAYERDGDVRGYLIYTIDDD
PTRDGRTMDVFEPAFADHDALLALLSFCHKHDSQVERVRLRLPADVPLLDIAQRPDAVET
TVETGPMVRIVDVAEALSAVSYPDLAAPASITLSVTDPVADWNEGAFALSVSEGRGTCDR
VAADAGSDPDPDADAHLDIGALSQLVVGYRSATDLERTGRLETGDSATLETLEALFSETA
VYLGDRF
Download sequence
Identical sequences F8D7F1
gi|336254643|ref|YP_004597750.1| WP_013880761.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]