SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385802408|ref|YP_005838808.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385802408|ref|YP_005838808.1|
Domain Number 1 Region: 17-101
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.26e-32
Family Imidazole glycerol phosphate dehydratase 0.00026
Further Details:      
 
Domain Number 2 Region: 102-193
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.98e-27
Family Imidazole glycerol phosphate dehydratase 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385802408|ref|YP_005838808.1|
Sequence length 208
Comment imidazoleglycerol-phosphate dehydratase [Haloquadratum walsbyi C23]
Sequence
MTEDTETSSTGAGADDRTAAISRETAETTINVTLAVDGDGEATVDTGIGFFDHMLETFAK
HGLFDLTVRCDGDLDIDDHHTVEDVGIVLGKSFNNALGEKRGIVRYADRSVPLDEAVATV
IADISGRPHFEFSGSFSQPQIGGFTSDMARHFAYSFTMHSEITLHASIEGINAHHEVEAL
FKSLARTLDEATQLDPRRGDTPSTKGEL
Download sequence
Identical sequences G0LFZ0 Q18DL1
gi|385802408|ref|YP_005838808.1| gi|110667002|ref|YP_656813.1| 362976.HQ1026A WP_011570323.1.31310 WP_011570323.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]