SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385802554|ref|YP_005838954.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385802554|ref|YP_005838954.1|
Domain Number 1 Region: 538-710
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-37
Family ATP-dependent protease Lon (La), catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 136-208,301-511
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.86e-33
Family Extended AAA-ATPase domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385802554|ref|YP_005838954.1|
Sequence length 749
Comment ATP-dependent protease La [Haloquadratum walsbyi C23]
Sequence
MSNDTDSDENPPAEGSGFTDETPDSSQHGDDGLSEEHANAEAGTDTDTGANAGADGRSDD
SGREDHDDRGDRDRGHDSYNDSVDTVDPDGPTDRENGSIEELGSDVEVDAEVKDDVDEDD
LLGGLKISSTAEIDVPDRLVDQVIGQEHARDVVMKAAKQRRHVMMIGSPGTGKSMLAKAM
SELLPKEELQDVLVYHNPDDGNNPKVRTVPAGKGDQIVDAHKEEARKRNQMRSFLMWIII
AIVLGYSLIIAGQILLGILAAGVIYLAFRYGSRGGDAMIPNLIVNNADTATAPFEDATGA
HAGALLGDVRHDPFQSGGMETPSHDRVEPGSIHKANKGVLYIDEINTLDIRSQQHLMTAI
QEGEFSITGQSERSSGAMVQTEAVPTDFIMIAAGNLDAMENMHPALRSRIKGYGYEVYMD
DTIEDTPDMRRKYTRFIAQEVNKDGRLPDYNAEAIEEIILEARRRAGRKGHLTLELRNLG
GLVRVAGDIARAADADYVRRDHVLQAKGRSRSIEQQLADDYIERRKDYELQVSDGYQAGR
VNGLAVMGEDSGIMLPVMAEVTPSQGPGQVIATGQLKEMAQEAVDNVSAIIKKFSDENIS
EKDMHIQFVQTGQQGVDGDSASITVATAVISALENVGVDQSLAMTGSLSVRGDVLPVGGV
THKIEAAAKSGCERIIIPAANSQDVMIEEEYEEMVEIIPVSHISEVLDIALEGEAEKDSL
VARLKSITGSALSQSKNETVSGPSNPSPQ
Download sequence
Identical sequences G0LGE7 Q18DX8
gi|110667137|ref|YP_656948.1| 362976.HQ1163A WP_011570458.1.31310 WP_011570458.1.96088 gi|385802554|ref|YP_005838954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]