SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385802655|ref|YP_005839055.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385802655|ref|YP_005839055.1|
Domain Number 1 Region: 205-332
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-26
Family Histidine kinase 0.0049
Further Details:      
 
Domain Number 2 Region: 33-138
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.01e-16
Family Heme-binding PAS domain 0.036
Further Details:      
 
Domain Number 3 Region: 120-192
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000902
Family Homodimeric domain of signal transducing histidine kinase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385802655|ref|YP_005839055.1|
Sequence length 365
Comment sensor box histidine kinase [Haloquadratum walsbyi C23]
Sequence
MMRELANESESADGIFQQLLDELDDVVVVRAAETGKTLAVNDAVEDVFGYTSAEFRSLDI
ADYTAGPNSPDEARAQEAYETARKVGSATFLWRAERHDGDPFWAEVNVSQTMIDDQEYLV
SVIRDITKYKTREIELERLASVLSHDLRNPLNAAKAQTTHLREQTGCQNEFVDRLEDLHD
RMLNIVDDVLTAVTEDQQITDIESIHLDSIVNDAWKTVGGDGKLKLRDNLGVIEADRHRL
QRLFENLFENAIVHSDETVTVTVSKIDGGILISDDGPGIPEDDRDQVLKYGYTTAESGTG
FGLNIVSTIADAHGWELTVGESVDGGAQFRLTGISRDHSDEDNINPTRSSSSWSEKIDDH
SHEQE
Download sequence
Identical sequences G0LHN4
WP_014555171.1.96088 gi|385802655|ref|YP_005839055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]