SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385802844|ref|YP_005839244.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385802844|ref|YP_005839244.1|
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-49
Family DNA gyrase/MutL, N-terminal domain 0.00000642
Further Details:      
 
Domain Number 2 Region: 569-761
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 9.81e-46
Family DNA mismatch repair protein MutL 0.0036
Further Details:      
 
Domain Number 3 Region: 196-335
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3e-35
Family DNA gyrase/MutL, second domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385802844|ref|YP_005839244.1|
Sequence length 772
Comment DNA mismatch repair protein MutL [Haloquadratum walsbyi C23]
Sequence
MSSNENAITALDTETVRQIAAGEVVERPASVVKELIENSLDADATRISVAVESGGADGIR
IRDDGIGMDEDAVQRAIKEHTTSKIDDINDLASGVGTLGFRGEALYTISAVSKMTIRTKP
RDGNRGTELHIEGGTVVDVEAAGCPEGTVVEIRDLFFNTPARRKFLKTTATEFDHINTVV
THYALANPDVAITLEHNDREVFATTGRGNLESAVLSVYGREVAESMISITTGDIESDRIT
AIEGLISHPETTRSTRQYLSTFINGRYVEARALREAIINAYGDQLAANRYPFALLFLDID
PGSIDVNVHPRKMEVRFDNETGVRDAVTNAIREALLSAGLIRSRAPRGQSAPAETEITQS
SPDVTTKSANDDTNVDNNEITETSVHTSAEKSEPNNNIKNTTQAQSDAEDERTDITKSDV
GDKDQQRETSIDSSRDTTVEGADVDSETARHVDPRSDAAWTVDNNRRSEDADIDSSINQQ
SSQSSETIEASTPNATADTTVQSQSKSTEDVDNGHKGAGEECDAVVSGNNHNKNQSEKAD
PNDSVNEQSVQHDLGGDVATLEPTVESLPSLRILGQIDETYIIAESDDGLVLIDQHAADE
RINYEQLQATLAETVTTQALAEPVKIELTAGESAQVEEYADALERVGFRVTDGDGDNIVV
TAVPAAFASALDPALVRDVLAETAESLNSHDRSETIKTLTDDILADLACYPSLTGNTALT
EGSTVNLLEQLDTCENPYACPHGRPVLIEFDRTELDARFERDYPGHKDRRLE
Download sequence
Identical sequences G0LK56
WP_014555328.1.96088 gi|385802844|ref|YP_005839244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]