SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385803104|ref|YP_005839504.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385803104|ref|YP_005839504.1|
Domain Number 1 Region: 1363-1424,1856-2124
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-59
Family DNA polymerase I 0.0013
Further Details:      
 
Domain Number 2 Region: 895-1020
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.28e-34
Family DNA polymerase I 0.0013
Further Details:      
 
Domain Number 3 Region: 735-893
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.66e-32
Family DnaQ-like 3'-5' exonuclease 0.00041
Further Details:      
 
Domain Number 4 Region: 74-310
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.09e-31
Family DnaQ-like 3'-5' exonuclease 0.0017
Further Details:      
 
Domain Number 5 Region: 306-411,695-738
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.14e-21
Family Intein (protein splicing domain) 0.02
Further Details:      
 
Domain Number 6 Region: 1019-1117
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.5e-17
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.024
Further Details:      
 
Domain Number 7 Region: 1476-1557,1823-1856
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000471
Family Intein (protein splicing domain) 0.018
Further Details:      
 
Domain Number 8 Region: 1257-1321
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000176
Family Intein endonuclease 0.015
Further Details:      
 
Domain Number 9 Region: 1724-1817
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000204
Family Group I mobile intron endonuclease 0.067
Further Details:      
 
Weak hits

Sequence:  gi|385803104|ref|YP_005839504.1|
Domain Number - Region: 556-612
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00737
Family Intein endonuclease 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385803104|ref|YP_005839504.1|
Sequence length 2129
Comment DNA-directed DNA polymerase B [Haloquadratum walsbyi C23]
Sequence
MKQAGLSDNWSDAADSGAGTSNARPDAEALAVAGKDTQHVSAIVDADEVRFPDADGSVEL
LVTQVNYSVERAGHEEYPVVHIFGRTADDTAHHVRVLGFEPYFYAPTESLNDDLLDNDAI
TRTESGYESIRGEELTKICTRTPRDVGQIRDDFDHYEADILFPNRLLIDKDIKSGIRVPA
RRLADKPQTIQIPHTEIEPVDVEANLRVNTFDIEVDDRSGFPEDGEEPIVCLTSHDSERD
EYITWLYNAPNAAEDTDPPDSLDRDDAIRSDTTADVRTFNREDAMLDAFVSYIEQTDPDI
LTGWNCLPSDARIQMADGTETEIHAVEIGDNVIGTTDQRSVTATVTNKWKSEREIYEFSL
ADGTSLRSSGDHRIMISDSNTVGWKSGSDIEQGEYVLKPRQLPVDDPTIPIINNLLSSES
ANIIDTLEVDALDSTGRSMNIHSSNPRESIAHTATLSMADGGDQKQRNETTNNTLDLNRT
VTKQDLYAIGRVLHNRITPRQDGITPVSQATLIDDSVLSSPSPANTQHQSDSILTEVISS
LRGLVSPGAHAIDFSAIYEMPKSHIAQFLAGTLDGSETDETTSSNLTITTESASIARWYA
RLYRRLGIYAQHQADAVHIANNACDLQRLSDAILPRLRCSDTIDYVKTQIDTVCDSSLKH
SQASSIGLSRDEANIRQFSDDGPQNKSYAAQPDSSDYDDDWNAYVFVEIEAITLNGTETT
YDIETTTHNFVADDCLVHNCDDFDVPYFLDRMEVINPQSEYTLTSERFSRIDEVWRSGWG
GPNIKGRVVFDLLYAYKRTQFTELESYRLDAVGELELDVGKERYPGDIGDLWEQDPQQLL
EYNLRDVELCVEIDRKQDIIAFWDEVRSFVGCKLEDATTPGDTVDIYILHEAHDRFALPS
KGRTDAEDYEGGAVFDPATGVKEMVGVLDLKSLYPMAMTTINASPETKVDPKNYDGDTFR
APNGTHFRRSPDGIIREMIDDLLAEREEKKSLRNEYDPGESVYEQYDRQQTAVKVIMNCF
TPDTNVLTPNGVRNIRDLTVGDSVYSLNPETMQMEIKPVTQTHEYPDYQGDLIDIQTNEI
DFRVTPNHRMLVEATGTDTTSTNDYDFIEAGNLDIASRYELPHGWSVDHTDSLGAYIDLI
ALLREQSDTYNVLSDGGMTTAATADINHNNVTRRVDSDTFVSLIGWYVATGRVSRTENGS
DRVYLQLSQTNAKARTQLTMLLDELGVDWQADNEKIHFVSHVWTELFDTTCGRTEKNKHI
PEFIFDASASQKRAFFDAIINGSGVKNDDSYQYHTSSEDLRDDILRLCVHIGIVARYDYI
NDESWRIECTETANPEFTLTHSGRQSTAEDGVYCVTVADNQTLLAGRNGTFQWTGNSLYG
VLGWDRFRLYDKEMGAAVTATGRDVIEHTADAASDLDKSVIYGDSVTGDRPVVVRDPSDY
IQIVPIKLLFEQATAPEQNIRLTADGAPSGNSEFPKERRHLDQWEALSLSDTGETEWQPI
DQIIRHQTDKEILTLQHEYGESTTTRDHSYITADDGGYVETSPENVDEPLPIPNIAPVKT
VETIDIYQTLTTDTQAQIGSDTEPDKWLPSADCIHANDEYVWIDTTDKQQHRDDSIPTIP
RYIDLSSDTGHALIRFLAVYLSDWSESTITTTERGRCLHITGPQESALKTCAADADQLFT
HITPSITVDAESNTNTVDSGFTCHIPTTLATALISAFAGHPAHTKQIPSIVYHLPAAEQS
LFIRHLIQAESTPESDGVSGRPQKSNKPILLENEFITTNRELAAGVSMLLTQCGQSYTIS
KQDTKGAYTIHINNSSPSGCTPTLTETTHSGYVYDLSVATNQNFVDGLGGLVLHNTDSVM
LELGDDITEQEAIEQSFEVEEYINDSYDEFAREELDAVRHRFEIEFEKLYRRFFQAGKKK
RYAGHIVWKEGKDVDDIDITGFEYKRSDIAPITKEVQRRVIEMIVHGEGTDSISEYLTDI
INDFESGNVPLEDIGIPGGIGKRLESYDTATAQVRGAKYANEFLGTNFGRGSKPKRVYLR
KVHPSWFREMETDSKFDPQRHGLYREFKRDPDVICFEYEDQIPDAFAVDWDLMLEKTLKG
PIERIIEALGMSWNEIKSGQEQTGLGNFI
Download sequence
Identical sequences G0LI31
WP_014555537.1.96088 gi|385803104|ref|YP_005839504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]