SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385803521|ref|YP_005839921.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385803521|ref|YP_005839921.1|
Domain Number 1 Region: 12-155
Classification Level Classification E-value
Superfamily CheY-like 1.25e-28
Family CheY-related 0.002
Further Details:      
 
Domain Number 2 Region: 709-866
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-28
Family Histidine kinase 0.0021
Further Details:      
 
Domain Number 3 Region: 641-717
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.55e-18
Family Homodimeric domain of signal transducing histidine kinase 0.003
Further Details:      
 
Domain Number 4 Region: 385-508
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.06e-16
Family BphP N-terminal domain-like 0.078
Further Details:      
 
Domain Number 5 Region: 257-386
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000133
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.029
Further Details:      
 
Domain Number 6 Region: 507-639
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000131
Family BphP N-terminal domain-like 0.052
Further Details:      
 
Domain Number 7 Region: 134-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000244
Family Heme-binding PAS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385803521|ref|YP_005839921.1|
Sequence length 886
Comment receiver/sensor box histidine kinase [Haloquadratum walsbyi C23]
Sequence
MATRQRRERRDTIRVLHVDDHSDFAEMVTTFLERENDRFETEAVASASDGLARLADSSFD
CVISDYDMPDADGIEFLKTVREKYPELPFILFTGKGSETVASEAISAGVTDYLQKSSGTE
QYKLLAHRITNAVEQSQSKQRVQEEQQRFRTLFDRLSQPTVEVRYKNSEPIVTQVNSAFE
DVFGYESNNIVGDSLDAHIVPDDRIDEAESMNQYVQAGGRLESREVIRETADGLRQFLLE
NAVCDNGLGGFFIYTDISDRVEREETLERNRDLLRHTEQLATVGGWEADVETGEIFWTRG
TYAIHDLDPTGEFEPSVETAIEFYHPDDQAAVEQAVEKCRTQGEAYEVDVRLITAEDEEK
WVCITGEAVYDGDDIVKIQGAICDITQQRKRRQELEQIETLFQNTQDHLFLINVDESFTI
ERLNPAWEATPGISVEESRGRTIQEVLGGKEAQKVEEKYQKCVEQRKELEYEERVRFGDE
YIQWETRLAPVIVDDEVEYIAGSSRDITERHERRQELSKLKQQYQTLAENFPNGAVYLID
DNFEYVRARGEALKQADLSPADIEGHTPHEVFPDELADETCKHFEQAFNGNTTVVEQEYR
NKRYRIRVTPVDGNGNTTKTNTETETEIARVMAVAQDITQYVEDRRELHRQNKQLDEFAS
VVSHDLRNPLTVAKGNLELLREECDSDDQREQVDKIDSALTRMDELIESILTLARANEQI
GSVESVNLAELSQNCWQNVETTDATIHLDITATQTVTVKADVNRLAQLLENLMRNAIEHA
RNQDDNVDKNENVTITIGELTDGFYIADDGDGISESDRDDVFEAGYTTSKHGTGFGLSIV
KQVVEAHGWEISITESADGGARFEVTNVEMSRSESTQLESNRMNSE
Download sequence
Identical sequences G0LHH6
WP_014555894.1.96088 gi|385803521|ref|YP_005839921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]