SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385803809|ref|YP_005840209.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385803809|ref|YP_005840209.1|
Domain Number 1 Region: 329-459
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-21
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Domain Number 2 Region: 534-601,644-715
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000885
Family Histidine kinase 0.014
Further Details:      
 
Weak hits

Sequence:  gi|385803809|ref|YP_005840209.1|
Domain Number - Region: 245-340
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000586
Family Heme-binding PAS domain 0.054
Further Details:      
 
Domain Number - Region: 453-518
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00235
Family Homodimeric domain of signal transducing histidine kinase 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385803809|ref|YP_005840209.1|
Sequence length 718
Comment sensor box histidine kinase [Haloquadratum walsbyi C23]
Sequence
MNHIWIAYLSVFGFATVACFTGAYRARRAVDNDFRTGLMWLFILAGVWSLTTAARIAVPD
MRVDIALRIGGLIIGLASIGAWLYVASAYAGFSYHQSTINRALALAVYLVIVIAKITNPI
HNLYFISAQKSLPFLHLSFNPGPLYWFVAGIAYTAVSIGLYWLFTTAPQARVDTTRFRAV
LALTAAPALLDVLVYADAIPTVLIEVSYAPLGMAFFALGTATVTNKELYSVSQSWRRQAL
DDIADAVVLTDAEGRIRYLGSNATAVFSTLAGSEGQLFETVAPQLSNLTHNSESFQWDQD
GATKYYNIIKRDIRSSGSQSGTVFAYIDVTESREARLQLAETEIKRQRFQQAIEAVDHSV
FMTDVRGTIEYINPAFEKNTGYDRSTLIGRSPAILNAPDAPNAYPDDLWEQIQDTGGRET
EVIQQRQDGTTYYTQQTITPINSQDASTTSYVVILTDITELKEHQQHLELLSRVLRHNLR
NDMNIARGYAETMISNTTDSNENYTANIVTTANDVITLAEQSTTITDLIIDPPESQEINL
SDVAQQTAERISETYTRASIDINCKETPPVRAIPQVRTAIEELINNAIIHSTSDTVSMTD
EFNRDTTVAHSADDESMQSLSLVSLPRSPDAAKTQVSITVERLPTENEVVVRVEDENQPI
PGMDRQILQRGTEIRSVYHGSGLGLWLVYWVVMRSNGTVDVETRDPSGNRIEMRFNQC
Download sequence
Identical sequences G0LL99
gi|385803809|ref|YP_005840209.1| WP_014556144.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]