SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804260|ref|YP_005840660.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804260|ref|YP_005840660.1|
Domain Number 1 Region: 595-685,732-863,897-1036
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.71e-88
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 1036-1187,1414-1474
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.55e-28
Family Intein (protein splicing domain) 0.019
Further Details:      
 
Domain Number 3 Region: 202-291,375-391,545-609
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.83e-26
Family Intein (protein splicing domain) 0.03
Further Details:      
 
Domain Number 4 Region: 1435-1649
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 8.55e-19
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.021
Further Details:      
 
Domain Number 5 Region: 1266-1360
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000102
Family Intein endonuclease 0.015
Further Details:      
 
Domain Number 6 Region: 460-561
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000068
Family Intein endonuclease 0.049
Further Details:      
 
Weak hits

Sequence:  gi|385804260|ref|YP_005840660.1|
Domain Number - Region: 131-198
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.000284
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804260|ref|YP_005840660.1|
Sequence length 1909
Comment ribonucleoside-diphosphate reductase,adenosylcobalamin-dependent (intein-containing) [Haloquadratum walsbyi C23]
Sequence
MDTHDVDADELELPIKRTTGETIEQRLTDNAYHNILPARYLRKDANGDLAESQEEIFERV
AQNVALAEAVFEADKQDAEITVTPDQLKPDHPRRDELAEEVFGAGADAADTVTTTLSVYN
VNKFAYETIVPELPDEVQHHVKSVADEFEDLMSRLSFMPNSPTLMNAGDELQQLSACFVD
SPSDDISDIHQTAKEAAEVFQCLTADSTVMLKEKGMVSVSEVETGDQIAQRSDTGFQYKP
VEETHAYENAETLTVTLTNGCSIRGTPNHRLMVDDEWTRIDEIQPGQEVHYTLGWLRETS
QSPPKLHPQSHTTVNQTADSISPDSSEPIELCESENADTGNRHNSAVAVKQSRTQAQLIS
DEVVSRPEHTRRPDQLSEELAELLGLWIDTGLWHQSGVQFNVERENIAEYIDQLSQQLFD
TPAAISDADGTYTVDITDHKLKEWWKANFGGKPDGTQSSYVPQMIKEAPTNVIEAFLRGC
FTAEGGLRKDMRPRLCTSSENSIDDIAVLMMGLGYPVEKSVIRNADGEPYYSVMPATDDG
LSAFLHDVGFIDERREIGLSNIESSGSRALDNTHKIEVESVVESPPATVYDITVADNHEY
VTDGIVSHNSGGGMGYAFWKLRPYGDSVGSTGGIASGPITFMRTYDQMCETIAQGGARRG
AQMGVMRISHPDVIQFIHAKNKDVSLAHSLRLNDPDDFTHTSFADALEEARELIDEEGRV
PEHLRNAVEGHLSNFNISVGVTDEFMEALFADEEFTFTNPRTEEPHIATPETKELYELHD
LGEHVEVGEELSVPAEELWDHIVSGAHENGEPGVIYLERVNKEHSFDVEKHSEHEILATN
PCGEQPLEEYEACNLGHINLSTLADKDAPDWRVWYDNNGDAYNNLDDAAEAFIYEAIDMN
AFNRRIESGTRFLENVVTMSDFPVDEIEATVRDMRKIGLGIMGLAQLYIQIGVRYGSEEA
NAIAEQLMTHINHESKWASHELAKDRGTFNDWTESKYADPTEYREWFEHHTGLDASEWED
GFLIRNHNTTTIAPTGCVEENSLVSTDEGLRPIKDLDNTTAEFEQWDEIDVGVTTDGGTK
TATAVYDNGFANVRQIQTESGFNIAATPNHRFRTLSSDGTYTWKEAGKFESGDRVILQRN
TFDAGSRVSLEANERADDAQDTTEGPELPGRMTSELAEFLGYFMGSGYISDETHASVDLV
VDSDATELNSYLSNLGEQLFRITPAVESQEMSQVLSFRDCHLSRYFEDNGWKKTDTGHSG
DASAAFVPEQILEGDEQVVNGFLRGVFEAIGTVSEKIEILTTSTTLADQLQSLLLSLGHV
FTRDTTKLIETNNYHDDQSRQRLCGATRREDERFMNEIGSLIEPDELNLSTRADKNDTYP
SSVIDHVQTLDGYDSVSESLKSRIDQSQVDGTVSRKLIKDIEAETAETVTIADRELTGFY
AATVESVTEDTAYTKDISVPSNNTYIADGFVTHNTTSMIGNTTGGCEPIYNVAYYKNVSD
DVQGDEMLVEFDDYFLRVLEQNDIDVEAVKQEAQEQMANNDFDGVDGLDTVPKAIGELFV
VTSDLSGKDHAGVQCACQEGIDSAISKTCNFPSSATKEDMDEVYRYIYQNGGKGVTVYRD
GTRSKQVLTTRAQNTEFADEGEAAETLVEQIEDVFGGVDSFLDNDTVRATVDDEIDRVLA
AADGNVELGKKRPRPDVLHGVTQRIDTGYGKLYVNINEDDAGRPFELFANIGNSGGFTAS
FTEALAKTVSTALRSGVDPREIASELQGIRSPKVAWDKGEQINSIPDAVGTAMRRYLDGE
IEKGYPQQQNLTEVGTDTGSEPRVESGSGSDAKAPGHETDGGAAVTDDTVSTNRNNGSLP
SANDENNDTDDVDSLVAAGESPECPECGSMSLYYSEGCKTCESCGWSEC
Download sequence
Identical sequences G0LJU8
gi|385804260|ref|YP_005840660.1| WP_014556498.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]