SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385804314|ref|YP_005840714.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804314|ref|YP_005840714.1|
Domain Number 1 Region: 13-70
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000735
Family Alr1493-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804314|ref|YP_005840714.1|
Sequence length 93
Comment conserved hypothetical protein [Haloquadratum walsbyi C23]
Sequence
MSQVSRRIVQELHDEPHLEGRRITVQFIKTQVEDRGLEPRTVADRHDIDVADVYRALTYY
HDHPEEMRAVERQREEAVEDHKHLTTDPDDVRD
Download sequence
Identical sequences G0LLW7
WP_014556536.1.96088 gi|385804314|ref|YP_005840714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]