SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804349|ref|YP_005840749.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804349|ref|YP_005840749.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-34
Family Translational machinery components 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385804349|ref|YP_005840749.1|
Sequence length 132
Comment 30S ribosomal protein S9 [Haloquadratum walsbyi C23]
Sequence
MVTNTSGKKKTAIARATVREGKGRVRIDSQPVELVEPEMSRLKMLEPFRIAGEDLRSQVD
IDVSVSGGGFAGQADATRTAIARGLVQYLNDAELRDAYMDFDRSLLVNDVRQSEPKKWGG
PGARARYQKSYR
Download sequence
Identical sequences G0LM04 Q18G59 U1N894
362976.HQ2938A WP_011572152.1.31310 WP_011572152.1.96088 gi|385804349|ref|YP_005840749.1| gi|110668831|ref|YP_658642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]