SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804441|ref|YP_005840841.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804441|ref|YP_005840841.1|
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000233
Family Alr1493-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804441|ref|YP_005840841.1|
Sequence length 76
Comment conserved hypothetical protein [Haloquadratum walsbyi C23]
Sequence
MGVVRDREHSDGAPTIEGTGIRVEDIASAYEHSGYSPDEITQLYPDLSLGDVHRALAYYY
DHIDDFRTSSSEPASA
Download sequence
Identical sequences A0A0M9ARA9 A0A256IEQ2 A0A256IG81 A0A256KWT8 G0LMB2
WP_014556651.1.11094 WP_014556651.1.84069 WP_014556651.1.96088 gi|385804441|ref|YP_005840841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]