SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804545|ref|YP_005840945.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804545|ref|YP_005840945.1|
Domain Number 1 Region: 39-135
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000278
Family Recombinase DNA-binding domain 0.028
Further Details:      
 
Weak hits

Sequence:  gi|385804545|ref|YP_005840945.1|
Domain Number - Region: 249-339
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0872
Family DnaQ-like 3'-5' exonuclease 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385804545|ref|YP_005840945.1|
Sequence length 364
Comment IS630-type transposase ISHwa7 [Haloquadratum walsbyi C23]
Sequence
MTGGRRKEITHHLSEKKIDELLREATDDRRKERLGFLKNLYYGDLIAEAADREGRSAATG
RRWADAWNEGGLEGLMPSFGGGRPPKLDEDEQEELLEMLRDGQPWKSQEIQHLLKEEFDV
EYHPDYLGKVLRELGLSYAKPRPKRPYRPENPEEILDERVGDALDEDETPHNREEGDDEE
GWTVDDDVCTDGGTVLGFFDASQPQPYDNSRRVWYVDDPHVERPLVKTEESAVGFYALNG
ESMVRWKETEKKERICEVLEAVREQNPGQRILLVLDKHGSHVCEYTRKRAHQLGIDLIFL
PSGSPHLNPIEQVWKYLKWTTAPIIVEDEDEFHELVRDVFDQVTQRISFAKDWCQKFLDL
QKFP
Download sequence
Identical sequences G0LMM3
gi|385804545|ref|YP_005840945.1| WP_014556739.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]