SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804719|ref|YP_005841119.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804719|ref|YP_005841119.1|
Domain Number 1 Region: 98-230
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.93e-44
Family CTP-dependent riboflavin kinase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 15-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000444
Family MarR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385804719|ref|YP_005841119.1|
Sequence length 234
Comment CTP-dependent riboflavin kinase [Haloquadratum walsbyi C23]
Sequence
MAESTTAVGHDELAALKFVALEGAHSEPIKISCSELSDRLDASSQTASRRLQRLEAAGYL
DRDVVTDGQWVSLTKAGETALHKEYTQYQEIFGDNSSVVELTGTVTSGMGEGRHYISLSG
YMKQFRERLGYEPFPGTLNIDLDDDSTRTRVAVSSLTGIQIDGWEDDERTFGPATCYPAE
IILAEQTAEAAHIIVPERTHHDETQLEVIAPERLRDSLELTDGQRITVQLKPKE
Download sequence
Identical sequences G0LN62 Q18FC4
gi|385804719|ref|YP_005841119.1| WP_011572439.1.31310 WP_011572439.1.96088 gi|110669118|ref|YP_658929.1| 362976.HQ3236A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]