SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804826|ref|YP_005841226.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804826|ref|YP_005841226.1|
Domain Number 1 Region: 11-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-67
Family G proteins 0.00000871
Further Details:      
 
Domain Number 2 Region: 465-622
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-39
Family Translational machinery components 0.00025
Further Details:      
 
Domain Number 3 Region: 260-380
Classification Level Classification E-value
Superfamily Translation proteins 1.77e-24
Family Elongation factors 0.0037
Further Details:      
 
Domain Number 4 Region: 624-718
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.41e-20
Family EF-G/eEF-2 domains III and V 0.0021
Further Details:      
 
Domain Number 5 Region: 388-463
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.83e-18
Family EF-G/eEF-2 domains III and V 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385804826|ref|YP_005841226.1|
Sequence length 729
Comment translation elongation factor aEF-2 [Haloquadratum walsbyi C23]
Sequence
MGRRKKIVQECEQLMDAPGQIRNIAIAAHVDHGKTTLTDNLLAGAGMIADEGEATRLMMD
TEEDEQERGITIDAANVSMTHTYEDTNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD
AVEGAMPQTETVVRQALREGVKPALFINKVDRLISELQEGPQEMQERLQTVIADVNELIR
GMTENRDDINDWTVSVEDGTVAFGSALYKWGVSAPSMIETGIGFPEIIEMEQNDKRKQLH
EETPLSDVVLDMVAEHFPDPLDAQPRRIPRVWRGDDSSNLATQMRDVTDDGDVVFMVTDI
SMDPHAGEIATGRLFSGTLEKGQELYVSGTVGTNRVQSVGIFMGGEREELDRGVPAGNIA
AVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEATNMDDLPKLIQTLQQVAKEDP
TIRVEINEDTGEHLISGQGELHLEVITKRIQSNQGIPVQTGEPIVVYRESPQNASREVEG
VSPNRHNKFYITVEQLSNDIVDAIQLGEVSMDMPELERREALQEAGMDKDTSQEVEHIHG
TNILIDDTKGIQHLNETMELVIEGLEEALDDGPLAAEPTQGALLRLHDAKLHEDTIHRGP
AQVIPAIRDAVHRALIDGDIKLLEPIQDVRIDVPSAHMGSASGEIQGRRGRVDDMFQEGD
LMVIEGIAPVGEMIGFSSDIRSATEGRASWNTENAGFRVLSDTLQREKIMEIRERKGMKL
ELPGSVDQF
Download sequence
Identical sequences G0LF84
gi|385804826|ref|YP_005841226.1| WP_014556969.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]