SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804850|ref|YP_005841250.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804850|ref|YP_005841250.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.07e-61
Family Phosphate binding protein-like 0.0000509
Further Details:      
 
Domain Number 2 Region: 209-279
Classification Level Classification E-value
Superfamily GlnB-like 1.89e-21
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804850|ref|YP_005841250.1|
Sequence length 281
Comment ATP phosphoribosyltransferase [Haloquadratum walsbyi C23]
Sequence
MRIAVPNKGRLHDPSVTLLERAGLHVEGAAERKLYADTVDPDVRLLFARAADIPQYVRDG
AAAVGITGRDQVIESGCDLIELVDLEFGRCQLVLAAPEDGALSSPADVAGGSVATEFPRV
TRQYLKDNAVDAEIVEVTGATELTPHVEMADAIVDITSTGTTLRMNGLTVIDEVLESSVR
LYAHPERVDDSKVEQLVTAFNSVLAAEGKRYLMMNAPQDRLDAVREVIPGLGGPTVMDVA
GEDTVAVHVVVDERDVFEIVSKLKTVGASGILVTEIERLVE
Download sequence
Identical sequences A5YSW2 G0LFA8 Q18EV8
362976.HQ3412A gi|385804850|ref|YP_005841250.1| gi|110669286|ref|YP_659097.1| WP_011572606.1.31310 WP_011572606.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]