SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804883|ref|YP_005841283.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804883|ref|YP_005841283.1|
Domain Number 1 Region: 10-120
Classification Level Classification E-value
Superfamily GlnB-like 1.68e-35
Family Prokaryotic signal transducing protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385804883|ref|YP_005841283.1|
Sequence length 120
Comment GlnK-type ammonia transport regulator [Haloquadratum walsbyi C23]
Sequence
MSKNNTGEIQLVMAYIRPDKLTDVKKALAETGAPSLTVTNVSGRGSQPAKKSQYRGEEYT
VDLHEKVKVECVVADIPAEDVVSAIESGAHTGEPGDGKVFVLPVEAATQIRTGKTGPDAV
Download sequence
Identical sequences G0LFE4 Q18ES7
gi|385804883|ref|YP_005841283.1| gi|110669317|ref|YP_659128.1| 362976.HQ3445A WP_011572637.1.31310 WP_011572637.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]