SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804970|ref|YP_005841370.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804970|ref|YP_005841370.1|
Domain Number 1 Region: 18-246
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-51
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000494
Further Details:      
 
Domain Number 2 Region: 336-451,507-545
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.85e-28
Family Intein (protein splicing domain) 0.023
Further Details:      
 
Domain Number 3 Region: 1132-1253,1304-1343
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.02e-25
Family Intein (protein splicing domain) 0.004
Further Details:      
 
Domain Number 4 Region: 572-693,788-804,1038-1092
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.22e-24
Family Intein (protein splicing domain) 0.0062
Further Details:      
 
Domain Number 5 Region: 1359-1478,1887-1929
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.68e-24
Family Intein (protein splicing domain) 0.04
Further Details:      
 
Domain Number 6 Region: 1857-2136
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000435
Family Extended AAA-ATPase domain 0.02
Further Details:      
 
Domain Number 7 Region: 892-942
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000055
Family Intein endonuclease 0.016
Further Details:      
 
Domain Number 8 Region: 276-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000304
Family Extended AAA-ATPase domain 0.056
Further Details:      
 
Weak hits

Sequence:  gi|385804970|ref|YP_005841370.1|
Domain Number - Region: 1617-1678
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000119
Family Intein endonuclease 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804970|ref|YP_005841370.1|
Sequence length 2216
Comment ATP-dependent DNA helicase MCM (intein-containing) [Haloquadratum walsbyi C23]
Sequence
MAQAPQDPQDLTDRFIQFYRKYYRDDIGTLAQQFPHEKRSLYIDYHDLYAFDIELAEDYR
REPDQLREYAEEALRLYDLPADVKLGRAHVRMRSLPDTVDIRNIRVHDDHIGHLIAVQGI
VRKATDVRPKITEAAFECQRCGTMTYIPQSDSGFQEPHECQGCERQGPFDVDFDQSEFID
AQKVRVQESPEGLRGGETPQSIDVDLEDDATGAVTAGDHVTTTGVLHIEQQTSGNEKTPI
FDIYMDGRSVEIEDEEFDDMDITDEDVAEIVELSNDPDIYEKMVESVAPSIYGYDEEKLA
MILQLFSGVTKHLPDGSRIRGDLHMLLIGDPGTGKCVSGETDIALVEGKTATIGELVESA
LTDPKPVDDGVWDTADFTVTSAIETGELTERDVTRVWKRQSPETMRQIQTASGRSVTVTP
SHPVFVEHNGSYTARRADSLSAGESVAIADDVADSRPISVDNTANTLNPRSMSTPGVTTD
GGLHRTGSDGGIVHAEVDEEDVTDCLTTDRITAVKTVTPTAEWVYDLEVEGTHAYLTNGV
LSHNSAMLQYIRNIAPRSVYTSGKGSSSAGLCVTGETRIHTTDGFVPLKQLATQHHPKTV
TTETAAAYERELYTVDPTTQSAEVTQSKSSHVWRMPEKHCRRIRTASGKQLEASVNTPVL
TVDDAEIKWKPISAIESNDSIVIPQYNNVERSSVSITDIFEFTQEQLKLTEKSITILRSK
IVSQYQNIAAAADALNIDVNSVEALITGQPVVSDVIDRVCDAISVSSEDITIHHVIGPTG
TAIELPEVLNDDLLYLLGAAFACGNIMTGETCEERWIQFHAPEESIRSHIIDAAVATFGS
ESIQTDTEQANTVQVISATVTRLFETLGLEQITDAAPREIHPRLTAVSGVDAFIRGLFDT
GGRIDNKNTPQIAIGTASEPLAEQIQLLLETYGIGSCRDTGDQSHTGTSTTQGQYLTLTG
SDAQAYRTTIGTRTESGSSWDRQVSSSHVGSEPSVRSTTTDTQKRTDMHEHEIISAGDVS
TVSSVESDGGTPQMPRSNIEPQSIGYDYESSRVNEIQTETVVEAVNTGKKEVFDLTVPNT
QNFIGGGIVTHNTAAAVRDDFGDGQQWTLEAGALVLADKGIAAVDELDKMRCVTGETLVS
LADGRHVPIASLATDASKTGTIESKPDGVGRTIRGIDNLTVWTMTENKQLTGRPVTAIHQ
YDSPDTLWQITLSDGSEVTTTADHPFIIINRDGVHECPAKHLSENDEVYTPADGFTASTF
DVTPDSETSSDSLPDGGITQTRTNQYSSHRCDVDLSDDVLLDVTTKTIESIETVHPSDGT
DVYDLTVSGTHNFVANGMIVHNSEDRSAMHEALEQQSYHPRSEVLLADGQRIDIGTFVDS
RIEKNNANVIDGINCEILPVDDVDVYTVDTDTGSASTVSIDRVSRHPAPSEFIRVKFSNG
RSVLVTPEHPMFIDDGSETKTVQANALSGGEFVPAPHHLPGVNTDTSTVSDDINDVSTIR
THVRSRARAKAEVEVQATDGEFKLIDAAQTLGIMTAVGKVSVDAPERGIIVDMDRTVDSS
KDAINNVLGSVIPSNDNDSITRAQDTGSTGNQWRWSVNTFVERMIEIAPAVTADRPNRRV
PDAVLGGSEAVVQQFLTGVIIAAGRILDETIRIYASSNELACDYADAFLRLGITASVEDG
PAEIAAQTVIKRDSDYERACGMFDISSSRTTPSDTSSQNNQSSVTAQNEDTHQTTSHEIL
PSGIADELQSIRQLLNIPASEQLASITAGDDGIALSIARAEINLLRDHIETLRMDTDNVS
IGRDDCATPTISSSSKYKYAKNGITSDENLQLFGQSQAQFSERTKTTASSPISASTDLVS
IPANISENRLVAATQRLDEVETRCNRRYHRVIAVDTVSNAGPHACEWVYDITVEPTNTFI
SSGVILHNSISVSKAGINATLKSRCSLLGAANPKYGRFDQYEPIGEQIDLEPALISRFDL
IFTVTDEPDPDADAKLADHIINTNYAGELHTQKANIPNSEFTDGEVESATAEVTPTIDAE
LLRKYVAYARRNCYPTMTDDAQDVIRKFYVDFRAKGADDDAPVPVTARKLEALVRLSEAS
ARLRLSDTVEQEDAKRVTSIVESCLRDIGMDPETGEFDADIVETGTSKNQRDRIKNLKHL
IENIEADYDDGAPVDEVIEQAISELGLSESKAEGEIENLRAKGEVYEPRTGSLRTT
Download sequence
Identical sequences G0LFN8
gi|385804970|ref|YP_005841370.1| WP_014557079.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]