SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804979|ref|YP_005841379.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804979|ref|YP_005841379.1|
Domain Number 1 Region: 385-540
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-37
Family Extended AAA-ATPase domain 0.00000481
Further Details:      
 
Domain Number 2 Region: 60-180,336-377
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.19e-22
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.023
Further Details:      
 
Domain Number 3 Region: 559-645
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 6.8e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00021
Further Details:      
 
Domain Number 4 Region: 16-61
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000211
Family Extended AAA-ATPase domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804979|ref|YP_005841379.1|
Sequence length 649
Comment replication factor C small subunit [Haloquadratum walsbyi C23]
Sequence
MSEADASDAAPTGREIWIEKYRPATLENIYGQEDTVDRLQSYIDRDDLPHLLFAGPAGVG
KCVTGSTPILTNKGIRQIGEIVGDVDGFAPAPQNLKVCSLTADGSFQYRHPSHVFGKRAS
GLQRIKTNDGATLTVTPEHKLLIRTGENTNPTWVPAADITAGMHVLRAKNLPVPAETTGS
CAASRNASEVPHIEDEYRYHDTLTADVNTRIATLERLIEDYAASRSDGSLKFTLIGAHTP
TVSTVSYLLATVGIASRHTSTLIDSEKRVHAIIIDASDTVRLEEMIETDWDTVMADQTTT
VTSSPTASTTKTTQSHLSNGETQTCGWIPYADGGVTHPSTQHSPLHADVVTVSESLDAEK
RVYDLTVPGVRNYVGGCIPTVMHNTTAATAIAHAVYGDDWQNNLLELNASDERGIDVVRD
RIKNFARSSFGGYDHRIIFLDEADSLTDDAQSALRRTMEQFADNTRFILSCNYSSKIIDP
IQSRCAVFRFSPLSETAIRGQTKDIAAAENIELTEDGLDALVYAAGGDMRRAINSLQAAA
TTGEVVDEETVYTITSTARPEDIETMVTAAIDGDFTTARSQLQTLLVDTGMAGGDIIDQL
HRTAWNLDLDEETTVRLLERVGEADYRITVGANEQVQLEALLASLADTQ
Download sequence
Identical sequences G0LFP7
WP_014557087.1.96088 gi|385804979|ref|YP_005841379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]