SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385805003|ref|YP_005841403.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805003|ref|YP_005841403.1|
Domain Number 1 Region: 81-390
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.47e-102
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000383
Further Details:      
 
Domain Number 2 Region: 475-652
Classification Level Classification E-value
Superfamily RuvA domain 2-like 6.3e-51
Family NAD+-dependent DNA ligase, domain 3 0.00017
Further Details:      
 
Domain Number 3 Region: 393-470
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.25e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00063
Further Details:      
 
Domain Number 4 Region: 663-737
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000129
Family DNA ligase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385805003|ref|YP_005841403.1|
Sequence length 747
Comment DNA ligase (NAD) [Haloquadratum walsbyi C23]
Sequence
MSTTISDSIASMISRINDIVITVVPSGDSNDSHRHSQIICDGGRTIQPLDDSSETTLAYA
DPNNSYLNNIDGDFRPIEQLSEEAAVEQATQLREAIREHDYQYYIRASPIIADRAYDILF
DRLQALEDIFNLDTGASPTRRVGGEPLDELETVEHVTSMLSIDQSTAVDSVRDFDERVRD
VVGDLEYICEPKFDGLSVEVIYEDGEYIRAATRGDGNRGDDVTAQVETIGAVPLKLHGDY
PSYLAVRGEVYMPKAGFREYNRERIECDEKPFANPRNAAAGTLRQLDPGVVAERPLSCFF
YDILDATELPPDQWTTLSDLQSWGLRTNDRISRVDSIDDAIAYRDQLKAARAELNYEIDG
TVIKVNDRGNREILGATSRSVRWAFAYKFPPRAEITHITDIVVQVGRTGRLTPVALLDPV
DVGGVTVSRASLHNPEEIKRLSVNSGDEVRVRRAGDVIPEVAEVTQKRATGTFNFPNQCP
ICHSSVEQDGPLAFCTGGLTCDAQLVRTIVHYGSRSALDIDGLGEQRVEQLVEAGIIGEL
ADLYTLSVADLSKLDGWGTTSAENLIQAISETQTPSLTDFLVGLGIPEVGPTIARNLAGT
FNNFDAIIDADEAALREIEDIGPTVSTHISEFFTNEQNRAAIDNLLSAGVTPQTQQSTAT
TNAPLSDLTFVFTGSLSVPRTTATTYIERHGGNATGSVSTNTDYLVIGDNPGSTKRIDAE
RNDVPEINETEFTELLAEHDDTLTWPP
Download sequence
Identical sequences G0LFS3
gi|385805003|ref|YP_005841403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]