SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385803796|ref|YP_005840196.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385803796|ref|YP_005840196.1|
Domain Number 1 Region: 643-771
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-21
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 2 Region: 159-280
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.97e-20
Family Heme-binding PAS domain 0.055
Further Details:      
 
Domain Number 3 Region: 774-890
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.21e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.068
Further Details:      
 
Domain Number 4 Region: 396-526
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000113
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 5 Region: 525-641
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000209
Family Heme-binding PAS domain 0.041
Further Details:      
 
Domain Number 6 Region: 14-158
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000051
Family GAF domain 0.0069
Further Details:      
 
Domain Number 7 Region: 284-397
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000855
Family Heme-binding PAS domain 0.031
Further Details:      
 
Domain Number 8 Region: 893-1011
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000541
Family Flavin-binding PAS domain 0.07
Further Details:      
 
Weak hits

Sequence:  gi|385803796|ref|YP_005840196.1|
Domain Number - Region: 1190-1232
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000973
Family Histidine kinase 0.016
Further Details:      
 
Domain Number - Region: 1007-1072
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0942
Family Homodimeric domain of signal transducing histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385803796|ref|YP_005840196.1|
Sequence length 1246
Comment sensor box histidine kinase [Haloquadratum walsbyi C23]
Sequence
MRSAPDGVTESNHSGLLRLSSELNHSKSIPDAAAVVVKMFDIEFDAPLSAVWQYDEETEL
LDPIARSAQANKIIGEIPTLPPQSLAGQTYDEQQTKHIRNVPEAERVYNPDTPIQSEIIV
PIPAFGVISIGITEVDAFSDSDVRLTELTASNLEAAVNRIRREQQSKTQREWRQILFEGS
RDAIIVSDPSGSIIEVNTAACTMTGYDRSELCNQRLKRVLFDSDAETYQSYYQRVLDGES
LSDEIQISCADDDHIIGSYSSRRIEVNGSVYVHTTVRDITDEYTRRERLASLESAIDEAN
DGVAVFENGEYAYVDETHLELYGFDSKEQLLGENWRVLYDDPTEIERIESEILPTVRNKG
HWRGNVAASNGEKRYPTELSLTLIDDSRIVCIARDVSEKQARVQELRQNERRFRSVFEDP
ELLVGLMETDGTVIDINQRAMEYVSADYATICGMEVWKTEFYNHDEELATSIQNWVDRAA
DGEYISYESEIPDETGNTRYLSGTIRPVTNEGGTIQSLLITAYDVTQRKRRQEELESFQQ
AIEQANDGVAILEDDGYSYVDETHVEMYGFESKADLLGESWHRLYGEEEIERLQSEAFRA
LESTGYWRGGVTGTRSNGDTFPAEISLTAVEHGSIVCTVRDETEKKKQKQQLQRKRQQFE
LLTENIDEYAFLVLDSDGIITSWNDGAENLFGYDPETAVGMSATVLHPGSDQQENIIQRL
LTQASMQGESAHEGRRMCKDGSMFYADVRCTPLETDDGSFLGYGLIVHNLTPKRRQQQRT
ERFVEESVDVVTVVDEDGTFSYVSTASQRVLGHEAEALSGTNVFDYIHVSDQEAVMSDFV
SIIENLTQTFECEFRFRTADDTWVSVNARARNHIDDESVGGVLVYIRDISQAKKRARRFE
AIFNQQYQLSGLLNTDGTVLRVNNALSSAETEIVDDSQSIQFSELSLWTHSDDVLETVQQ
SVERAAGGESVQQTIEAMSADGLRLLDLSIRPITDSDGNITLLVVEARDITTQERERRHL
QVLQRIIRHNVRNDITKIRGFLDLILEADDHENRKDHAMKIYQVMDNWEAITEKTQQIQN
LIQKQGTGVEFVDAKTGLNEVIERFNSSKTGGSVYIETAETVTANMPDAVSAAVDELLQH
FTHEVGDTDSDTAVDINIELLTSTTDWITIRFTADRLLSKVKAAVLETGEETQLKHGKGL
SLWLVNVVIMQTGGSIAVERTTDGTIITIRIPTQSRRERADAITLT
Download sequence
Identical sequences G0LL84
WP_014556131.1.96088 gi|385803796|ref|YP_005840196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]