SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804024|ref|YP_005840424.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804024|ref|YP_005840424.1|
Domain Number 1 Region: 1010-1175
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.28e-56
Family DNA gyrase/MutL, second domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 117-237,565-609
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.44e-27
Family Intein (protein splicing domain) 0.014
Further Details:      
 
Domain Number 3 Region: 27-111
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-18
Family DNA gyrase/MutL, N-terminal domain 0.0038
Further Details:      
 
Domain Number 4 Region: 607-718
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000113
Family DNA gyrase/MutL, N-terminal domain 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|385804024|ref|YP_005840424.1|
Domain Number - Region: 740-785
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0918
Family Topoisomerase VI-B subunit middle domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385804024|ref|YP_005840424.1|
Sequence length 1304
Comment DNA topoisomerase VI subunit B [Haloquadratum walsbyi C23]
Sequence
MTSFQSTLGEEGEIADELAESQRAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDNALD
ATEEAGIKPDISIEIRESGDYYTLIVEDNGPGITREQVPKVFGKLLYGSRFHAREQSLTP
TQTLLIRRDGDVTFTSIGDFCDSYLPADGPASAPIPVDANIEVPSFDRATHEMTWQPVTN
AIRHRTDERVYRISTACGRTLEITGNHSLFSLSSDNETIEVNAGELSPGDSILAPKQLPM
ASESVDTGTTVDEKTQSSTGAQTQRINILEHIKPDDLKESAATFRIHEADQASLSSGGNH
KSSSASLASSQLASSEVIASAGGQQIQSSADQRQSKEHTPGGDHHNNECLSIKSVCENNK
MSTVADYTLEIVTPDGESSRLPVSVSIDNVFITSLVRYIATASTSDISPVSDSSVDYTTE
ESHNTVDRSFSDTMRPLDSVIPLICEDDGEIELPSFVFESDPKQQQQLLTQLYRYPEASN
GRNAGDDTVTYTTTSATLARQLTTLWNMNGVVATANTQTETSQSDEIKNESAQTTIYEVS
VDRAEIETDIAGSDSDCQQGDGDLCLVSVSSVEEIDAPPYVYDISVPGASGHDENFVTAN
DGAICVKNSRGQQGIGISAAVLYSQLTSGKPARITTRTQSSDTAQYFELIIDTDTNEPEV
SADQERDPGAASLSPTHGTRIELEMEANMRARGQLRDYVKDTAVVNPHARITLDEPGLEE
PRQYERVDGAELPAQTEEIRPHPHGVELGTLLKMLEATESYSVSGFLREEFTRVGSKTAT
KILDQFRDRHFGRALPMSAPETIPDNADDTDDEQVTSSLESIIEAAVVNKGASATTTFAS
RVAETVNQRSGTTQGELVGIVDTVAEDIEDEFETTFGTTVRENAVEAAWDVLTTDIDEDI
YPLVADATSTQKDHETVRGVTDRIATKFADGSEPLRATRDAVREYVDRSADMIVSEEVSF
GETARENVVDAVWTAMQTVDDELPAVKAVADDRNIASDLLEAMRLTDILAPPTDCLSPIT
ADLVEAGLRKEFDADFYAAATRDAEVHGGDPFIVEAGIAYGGELEGGKISLLRFANRVPL
VYQRGACATTDVIKSIGWRNYGLDQPGGSGMPNGPAVVMIHVASTNVPFTSESKDALANI
PAIEDEIELAVREASRELKSYLNKRRSMQKRREKQDVLGRILPEMANKLADVTENDRPDI
DNALARIMNNVSVERDVDNGSVTLTVQNYSDRQESPTLTDIVDSKPDTIPDKIEIVELED
EYFLTWEPVVDAGESATVTYEVPTGASFELDVDDVETEKLTIDA
Download sequence
Identical sequences G0LLH3
WP_014556314.1.96088 gi|385804024|ref|YP_005840424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]