SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385804455|ref|YP_005840855.1| from Haloquadratum walsbyi C23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385804455|ref|YP_005840855.1|
Domain Number 1 Region: 18-56
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000628
Family TTHA1013-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385804455|ref|YP_005840855.1|
Sequence length 90
Comment conserved hypothetical protein [Haloquadratum walsbyi C23]
Sequence
MSTDSSANHSDTPSAKITLTQNDDGWWTARDERRGLTTQGETRDDALDNLDDVIDAVEND
RGDQPTDEELREAGIDPEDNTTGELPDILK
Download sequence
Identical sequences G0LMD1
WP_014556665.1.96088 gi|385804455|ref|YP_005840855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]