SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336452430|ref|YP_004606896.1| from Helicobacter bizzozeronii CIII-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|336452430|ref|YP_004606896.1|
Domain Number - Region: 204-381
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0068
Family Pentapeptide repeats 0.011
Further Details:      
 
Domain Number - Region: 30-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0785
Family BAR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336452430|ref|YP_004606896.1|
Sequence length 404
Comment hypothetical protein HBZC1_01980 [Helicobacter bizzozeronii CIII-1]
Sequence
MQEVLEKLEQEIKSVKRACRLGKSVLEEGLEVKTEAQELHAKFSALIEALTHASKAVDEH
YASLEDDTALEEMLILLKRVRARINTPLASLEQASTAKEALDSLASLEKSILDVEGVLAS
LKEHPTLSTPTSPKATPQMAKKYCPQSKEELKKLVADESVHLGEIDISKIADLSWVFCYA
DSILAAEPKVFRRANFEGLETWDTSHVTNMEYMFYRAIFFNYDISSWNVSRVQNMDSMFH
GCEIFNQPLSSWNVSRVEKMAGMFLGCENFNQPLNTWDVSRVEAMGWMFQHCEDFNQPLD
NWDVSRVENMNYMFHGCTSFDQPLKDWNVSRVEEMHSMFKDCKNFNQSLNDWDVSKVKSM
RHMFSNCYNFNQNLDSWHVLSTASTKSMFDGCTALKTLPTWYKN
Download sequence
Identical sequences F8KQ01
gi|336452430|ref|YP_004606896.1| WP_013889689.1.34921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]