SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470462386|ref|YP_007628697.1| from Edwardsiella tarda C07-087

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470462386|ref|YP_007628697.1|
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily YccV-like 9.68e-25
Family YccV-like 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470462386|ref|YP_007628697.1|
Sequence length 106
Comment heat shock protein HspQ [Edwardsiella tarda C07-087]
Sequence
MITSKFGIGQQVRHKLLGSLGVVIDIDPEYALDDAPDDDDLGANEVLRHAPWYHVVMEDE
QGQPVHTYLAEAQLDGESSDSHPEQPSMDDLAESIRAQLLAPRLRN
Download sequence
Identical sequences A0A034SVC8 A0A076LT12 A0A0H3DTM4 D0ZG67
gi|470462386|ref|YP_007628697.1| gi|269138632|ref|YP_003295332.1| gi|387867331|ref|YP_005698800.1| 498217.ETAE_1278 WP_012848137.1.20341 WP_012848137.1.32191 WP_012848137.1.32312 WP_012848137.1.39507 WP_012848137.1.69651 WP_012848137.1.79796 WP_012848137.1.82304 WP_012848137.1.83294 WP_012848137.1.86133 WP_012848137.1.91532 WP_012848137.1.93273 WP_012848137.1.93403 WP_012848137.1.93598 WP_012848137.1.9786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]