SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470461675|ref|YP_007627986.1| from Edwardsiella tarda C07-087

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470461675|ref|YP_007627986.1|
Domain Number 1 Region: 15-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000122
Family Anti-sigma factor antagonist SpoIIaa 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470461675|ref|YP_007627986.1|
Sequence length 104
Comment anti-sigma-factor antagonist [Edwardsiella tarda C07-087]
Sequence
MTARGELRWRRVDATLYLQGALECDSLDALWQQRQTLLTGITCVDISELSRVDSAGLALL
LHVQNLRPETPIPLRGVSERLRTLITLYNLQDIVVCAAPSANLA
Download sequence
Identical sequences gi|470461675|ref|YP_007627986.1| WP_015460894.1.93403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]