SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470463747|ref|YP_007630058.1| from Edwardsiella tarda C07-087

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470463747|ref|YP_007630058.1|
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.61e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470463747|ref|YP_007630058.1|
Sequence length 112
Comment anti-sigma F factor antagonist / anti sigma b factor antagonist RsbV [Edwardsiella tarda C07-087]
Sequence
MNLAVEEVDGLTIVSPLIRRLDASVAGVFRQNVVTLIEQGHYRLLLDFSQVDFIDSSCLG
ALVSLLKLLNNRGDLLLCGLNENIQGMFRITRMDRVFHIGTDRQQMLAQHGA
Download sequence
Identical sequences A0A0H3DVK4 A0A1D7VB20 D0ZCI1
gi|470463747|ref|YP_007630058.1| gi|269140030|ref|YP_003296731.1| gi|387868546|ref|YP_005700015.1| 498217.ETAE_2685 WP_012849512.1.32191 WP_012849512.1.39507 WP_012849512.1.79796 WP_012849512.1.82304 WP_012849512.1.83294 WP_012849512.1.91532 WP_012849512.1.93403 WP_012849512.1.93598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]