SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0122800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0122800.1
Domain Number 1 Region: 93-134
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000373
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0122800.1
Sequence length 138
Comment pep:known scaffold:1.0:Oglab01_0114:50199:50615:-1 gene:ORGLA01G0122800 transcript:ORGLA01G0122800.1
Sequence
MHGGDRWRREQVGLATRWWPRSGSPGESSTAAGAAVWMRRLRCIGGGGDSSATAGMAVWM
RRLCCIGGGGDSSGSEGNGLDATAALHRREAGDGWMPMKLMKFKDKRATLTTGWNALVGA
NLFEQADVCVFLFTEVPM
Download sequence
Identical sequences I1NMY8
ORGLA01G0122800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]