SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0225300.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0225300.1
Domain Number 1 Region: 214-309
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-30
Family B3 DNA binding domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 80-136
Classification Level Classification E-value
Superfamily DNA-binding domain 4.25e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0225300.1
Sequence length 395
Comment pep:known scaffold:1.0:Oglab01_0227:629316:630503:-1 gene:ORGLA01G0225300 transcript:ORGLA01G0225300.1
Sequence
MDSSSCLVDDTNSGGSSTDKLRALAAAAAETAPLERMGSGASAVVDAAEPGAEADSGSGG
RVCGGGGGGAGGAGGKLPSSKFKGVVPQPNGRWGAQIYERHQRVWLGTFAGEDDAARAYD
VAAQRFRGRDAVTNFRPLAEADPDAAAELRFLATRSKTEVVDMLRKHTYFDELAQSKRAF
AASTPSAATTTASLSNGHLSSPRSPFAPAAARDHLFDKTVTPSDVGKLNRLVIPKQHAEK
HFPLQLPSAGGESKGVLLNFEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGD
VVGFYRSAASAGDDGKLFIDCKLVRSTGAALASPADQPAPSPVKAVRLFGVDLLTAPAPA
PVEQMAGCKRARDLAATTPPQAAAFKKQCIELALV
Download sequence
Identical sequences I1NQW3
ORGLA01G0225300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]