SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0349100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0349100.1
Domain Number 1 Region: 76-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.75e-22
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 571-661
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000706
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0349100.1
Sequence length 667
Comment pep:novel scaffold:1.0:Oglab01_0303:217878:221140:-1 gene:ORGLA01G0349100 transcript:ORGLA01G0349100.1
Sequence
MVELIKVPKIEQEEGNADSHGKEKADVVHEEKTEKVKRRRKRVSDPQRKKACVDCTKRCI
RIHGMASSSSEKARPTPTLPSFFKIMVGYFSENMDIPLPFARTITDMTGSNVYLEDAYGL
RWRVRLYLHDDVLSFGHGWKNFVLDHDISVGEFLVFRQIARSVFTVQIFAISACERIHLC
ERNKRQSRKRKPGRKTGYPANNQMVKVSSKDVVKRRKKPRTDEQRYDLDPRQHDMPVRVC
IDSGSELRCSESSVKELDAAPDKSHAVVQVPATECNADPSYNAAGMKTIKNLEAIGASSS
TKDVTWDANKSEDYPSFSYPESSNVMTADKESERSHQDRPMQLYCELGLEDGNAETENCE
NSNVLENAELRTPLAMMDLNEVGIDDIFLSADIYEFDSDFCSPEAFSVDVNTEGLVANGR
TPGDCFGMPETSRCLENKQMTDVPRTSTDDGSIAVHGIDINALPSNTYPDIDAAPDDCKK
DKDVLHSECNKVAQKAHSSVKQDITKDGPRQIAAEIMSSGPKTCELTYVRKNSVQPGYFT
SVGQYAGNNSKGQESGGTKSCVVLAVAANSKKFCITIPPPDQTWLELPRRLPVLPRTKKQ
ARKILILKDPSMRLWPVLYQCTPKFNGFIAGWADISRENNLREGDTCEFELCSNSELSFQ
VLVPNLQ
Download sequence
Identical sequences I1NUF1
ORGLA01G0349100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]