SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA02G0176700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA02G0176700.1
Domain Number 1 Region: 101-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-44
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 534-611
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000481
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA02G0176700.1
Sequence length 662
Comment pep:known scaffold:1.0:Oglab02_0236:127230:131120:1 gene:ORGLA02G0176700 transcript:ORGLA02G0176700.1
Sequence
GSSCDALYRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEASTDQQLDQHLPLFNLPSK
ILCKVVNVELRAETDSDEVYAQIMLQPEADQNELTSPKPEPHEPEKCNVHSFCKTLTASD
TSTHGGFSVLRRHAEECLPPLDMTQNPPWQELVARDLHGNEWHFRHIFRGQPRRHLLTTG
WSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISSHSMHLGVLATASH
AISTGTLFSVFYKPRTSQSEFVVSANKYLEAKNSKISVGMRFKMRFEGDEAPERRFSGTI
IGVGSMSTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEPLAVSNSQPSPQPPARNKR
ARPPASNSIAPELPPVFGLWKSSAESTQGFSFSGLQRTQELYPSSPNPIFSTSLNVGFST
KNEPSALSNKHFYWPMRETRADSYSASISKVPSEKKQEPSSAGCRLFGIEISSAVEATSP
LAAVSGVGQDQPAASVDAESDQLSQPSHANKSDAPAASSEPSPHETQSRQVRSCTKVIMQ
GMAVGRAVDLTRLHGYDDLRCKLEEMFDIQGELSASLKKWKVVYTDDEDDMMLVGDDPWP
EFCSMVKRIYIYTYEEAKQLTPKSKLPIIGDAIKPNRNKQSPESDMPHSDLDSTAPVTDK
DC
Download sequence
Identical sequences I1P1B1
ORGLA02G0176700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]