SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA02G0215100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA02G0215100.1
Domain Number 1 Region: 116-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-29
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA02G0215100.1
Sequence length 681
Comment pep:novel scaffold:1.0:Oglab02_0265:4295:6569:1 gene:ORGLA02G0215100 transcript:ORGLA02G0215100.1
Sequence
MITFADLAEPAPGAERCVDRQLWLACAGGMCTVPPVGAAVYYFPQGHAEHALGLAAPELS
AARVPALVPCRVASVRYMADPDTDEVFARIRLVPLRAAEDGDVEEDGAAAGEEHEKPASF
AKTLTQSDANNGGGFSVPRYCAETIFPRLDYAADPPVQTVVAKDVHGVAWNFRHIYRGTP
RRHLLTTGWSTFVNQKKLVAGDSIVFLRGDGGDLHVGIRRAKRGFCGGGGGAEEASLPGW
DQYGGLMRGNASPCAAAKGRGKVRAEDVVEAARLASGGQPFEVVYYPRASTPEFCVRAAA
VRAAMRVQWCPGMRFKMAFETEDSSRISWFMGTVAGVQVADPIRWPQSPWRLLQVTWDEP
DLLQNVKRVSPWLVELVSSMPAIHLSSFSPPRKKPRIPAYPEFPFEGQLLNPAFPPNPLA
HGHHHYHHNHPSFFPFPDVSAPAGIQGARHAQFGPSLSDLHLTHLQSSLMYPGLRHPDHV
GPTPIPPPRISTDLTMGSSPPARALSMGAKKPDDAKPPGLMLFGQRILTERQMSLSGTTS
PAATGNSSLNWNTEKGASEGSGSGVIQNSPTDNTSSERLQWFRENSTVSELGLEPGQCKV
FIESDTVGRNLDLSSLASFEQLYGRLSEMFCIDSAELRSRVLYRGATGEVRHAGDEPFSE
FIKLARRLTILTDAGSDNLGS
Download sequence
Identical sequences I1P2E5
ORGLA02G0215100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]