SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA03G0243600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA03G0243600.1
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-20
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 223-327
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-18
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 3 Region: 442-525
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-16
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA03G0243600.1
Sequence length 535
Comment pep:novel scaffold:1.0:Oglab03_0056:157729:161190:1 gene:ORGLA03G0243600 transcript:ORGLA03G0243600.1
Sequence
MAGGNTHRKKSCACCKEYLEHLGGKMRCFLRRMAADSMHSMIMPDRFVSHFGGKIPGTIK
LESPNGILYVVEVTECMNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRYEVLILDSDD
CEKVFSCAGTRNGSCVQDKTVDPVDSSGSSSNDTTQSSRSRNTENLTAMCSSSEKSGEDS
PSGYEFHESVEPQTPSGSDYVLSRRTYLSEAQKERVVAHIQDIQPEITVFVAVMKKCNLQ
SPAPYLVISSRYASVHFPRETATITLQRPSKRKKWYPRFYKRIDKSDHMLRGQWQNFVHD
NCLQEEDICLFVPTKGGRNFVFTVHLLQAEATHSRDGTDVHKIGSSQNKRNSKMASQVHI
KEAPGGDVSSESNKHGVSHESLESEDSDGPSEPPYISSMRRRLSQLQKKTVEEKVRAIQS
EIPICVATISKLAGSGGKGKFRGLELSSRYAASYLPDKNHQTLVLQCKGMIWQINLVVRR
RYTKGKRWFLTAGWRKFAHDNRLRVGDFCLFELKKKKLTMEVHIISNLQRYPEVE
Download sequence
Identical sequences I1PDJ0
ORGLA03G0243600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]