SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA03G0244700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA03G0244700.1
Domain Number 1 Region: 143-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-25
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 446-544
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.61e-23
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 726-825
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-22
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 927-1025
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-18
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 5 Region: 330-413
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-16
Family B3 DNA binding domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ORGLA03G0244700.1
Domain Number - Region: 635-696
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0314
Family B3 DNA binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA03G0244700.1
Sequence length 1028
Comment pep:known scaffold:1.0:Oglab03_0056:224302:234025:1 gene:ORGLA03G0244700 transcript:ORGLA03G0244700.1
Sequence
TAPFPASPVRLHPCPLLFSHPHLLGSDYFAFSVKGRGAHLESMRVENKRGNRSWGTDAKR
THPNSIFNQLVRYGYIGTGFPDMNCSLTWSLTGGPSTLSLPSFFPSAHLLLLLALFFLCI
QSNHRMSKSGCERCRGRGFWDTDDQDTYFFKVMIGGFRRQMTIPYKFAENFRDQIQGTIK
LKARNGNTCSVLVEKCSNKLVLTKGWAEFANSHDIKMGDFLVFRYTGNSQFEVKIFDPSG
CVKAASHNAVNIGQHAQNMQGDPIEILSCSDEHLRAQSLTTERQNQPEKDVIDNCNKKMK
TEHASSSEDDQETPTAEVHRMKVEEMVRAIHSNHPVFVAVMKKSNVTRQPCYVAISRKYA
NEYFPGGDQMLTLQRHGKRWQVKFCISKRKLRMLSKGWRKFTRDNELQVGAPLALFITLF
FSPHFRKMKKCGQKMRKLNTRSTARDDQEKYFFKVMIGDFHKRMTIPDKFARHFKGVISK
TIKLEPRSGYTFDVQVTKKLNILVLGSGWESFVNAHDLNMGDFLVFKYNGDFLLQVLIFD
PSGCEKSTSCSMENAIDHVGQGWKEHNDISTSYHDQPKGNKHWMQKDSSSKGNKIGNTRS
SNTPSKFSGCILPRGTCLPVVQEKKMKEKIQAIHSKTPMYGNVMTKCNVSGSPCVLEITQ
LYDDAYLPFNNGQELMLRHRDKSWKVRFYRFKNKSRKLTQASSLYKMRRPGARCREGHAH
FNGNHIDGQYKNFFKVMIGRFRERMIIPNEFLQYFRGKIPRTIKLQLRDGCTYDVQVTKN
LGKISLQSGWKAFVTAHDLQMGDFLVFSYDGISKLKVLIFGPSGCEKVHSRPTLKNATHC
GEKWEEPLHISSNSHDLPVKSPQNVSKSEKQWDSSEQENDTANIEEVALQGDDLQGHPVL
NCILPKHTRLTDMQKQQLESKVGAIHSEIPIYGCILRKSRVHGKSQTVDICREYADVYLP
FKELNMTLQRHGKNWEVLCRTKDTRTKRLSTGWSRFAQENNLQVGDICLFELLKKKEYSM
NVHIIPKK
Download sequence
Identical sequences I1PDK1
ORGLA03G0244700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]