SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0074500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0074500.1
Domain Number 1 Region: 90-189
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000334
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0074500.1
Sequence length 212
Comment pep:novel scaffold:1.0:Oglab04_0204:1305627:1306379:-1 gene:ORGLA04G0074500 transcript:ORGLA04G0074500.1
Sequence
TKAATALPSIPSSSSPSPMASDPTELRCSSPESSGDAGAEDPAAVDAAEESGGEGGSGHI
AAGTEAAPPRPPEPEPEKVARHGVLPLLGKPYFTCIMCKSHVQPPFQVVVPRSFAPLLPS
RTTPATLSWRGRSWGMRFTGGRLIQRLEAGWRGFAVDNDLRLGDGCVFELLVGGGGEQER
VEFRVQVLRAEIPARIRGRAGGYTSATPIVID
Download sequence
Identical sequences I1P630
ORGLA02G0343600.1 ORGLA04G0074500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]