SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0107000.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0107000.1
Domain Number 1 Region: 110-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-45
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 549-625
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000216
Family PB1 domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0107000.1
Sequence length 673
Comment pep:known scaffold:1.0:Oglab04_0221:574817:579477:1 gene:ORGLA04G0107000 transcript:ORGLA04G0107000.1
Sequence
MAAAMEMAANPGGSGTCSDALFRELWHACAGPLVTVPKRGERVYYFPQGHMEQLEASTNQ
QLDQYLPMFNLPSKILCSVVNVELRAEADSDEVYAQIMLQPEADQSELTSLDPELQDLEK
CTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMSQNPPCQELVAKDLHGTEWHFRH
IFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGESGELRVGVRRLMRQVNNMPSSVIS
SHSMHLGVLATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMRF
EGDEAPERRFSGTIIGIGSVPAMSKSPWADSDWKSLKVQWDEPSAIVRPDRVSPWELEPL
DASNPQPPQPPLRNKRARPPASPSVVVELPPSFGLWKPPSEAAQTLSFSEPQRAREIFPS
IPASIFSASSHVEFNSKNEPSILSNQFYWSMRDSKTDSFSASTNKARVERKQEPTTVGCR
LFGIEISSAVEEALPAATVSGVGYDQTVLSVDVDSDQISQPSNGNKSDAPGTSSERSPLE
SQSRQVRSCTKVIMQGMAVGRAVDLTKLNGYGDLRSKLEEMFDIQGDLCPTLKRWQVVYT
DDEDDMMLVGDDPWDEFCSMVKRIYIYSYEEAKLLAPKSKLPVIGDTIKLSSMNSSHESV
DLDNHASVTNRDC
Download sequence
Identical sequences I1PLK1
ORGLA04G0107000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]