SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0160200.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0160200.1
Domain Number 1 Region: 121-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-29
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0160200.1
Sequence length 393
Comment pep:known scaffold:1.0:Oglab04_0250:179652:180833:1 gene:ORGLA04G0160200 transcript:ORGLA04G0160200.1
Sequence
MLPFMELAGPTEGDGGGSVDSQLWAACAGSMSSVPPVGAAVYYFPQGHAEQASAAVDLSS
ARVPPLVPCRVVAVRFMADAESDEVFAKIRLVPLRPGDAVVDVGEAAAAEARREEENSSR
PRPTSFAKTLTQSDANNGGGFSVPRFCAETIFPELDYSSEPPVQSVCAKDVHGVEWTFRH
IYRGTPRRHLLTTGWSPFVNKKQLTAGDSIVFMRDEGGNIHVGLRRAKRGFCSIGGDDES
LSSMPGWDQYRGLMRRNATATATGGRTPPKGKVPPENVLTAATRATTGQPFEVLYYPRAS
TPEFCVRAAAVRTAMAVQWCPGMRFKMAFETEDSSRISWFMGTVAGVQASDPVRWPQSPW
RLLQVHIHGTNMRQPQLDHDRVVEFLINWPPRR
Download sequence
Identical sequences I1PN33
ORGLA04G0160200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]