SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA05G0071600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORGLA05G0071600.1
Domain Number - Region: 306-355
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0161
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA05G0071600.1
Sequence length 463
Comment pep:novel scaffold:1.0:Oglab05_0027:164725:166113:1 gene:ORGLA05G0071600 transcript:ORGLA05G0071600.1
Sequence
MDTSGMCAAAQVPRRQRSRREESMERTEGQVVVSTPSGSTGNGDGDGALVVSTTSWDRNR
TPRVRPRETTTVAAAADRSVLGGNGGGSVDVADGDSNNAEKEQRRKEEFDRERRRKGKMV
AEEESPSTASGGGMPIGLPAADKLMGYAIRGGRRQHVTTAIGTCKNTKRRGHGKFWASLG
RDGASTSSAGSDMVVPLDDIAVVHDRLRSLLNGLGAVSPPVRVYGKMMWRSDRLKSQNRL
QISRKKDGKLSPFDSILTLAEKSAATSKRKKKSSKPKNKKNGESKEKKDEHKEYNDNGTN
KPNNEPNNGDDGLFVQAYDRTGEEYILTLKYIKANNSYRLMGRPWKTFLKNCSLTLQEDA
KKKGKKAIKKVKKVAIANEAMIDLWVFRSQKLSHGKDDHNDGRLGLVMVHYFKGDAPHAD
AAFKANEELLLLAPKKRKKKHEGASSSHDAVTEALPQEEPNVV
Download sequence
Identical sequences I1PTL8
ORGLA05G0071600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]