SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0056900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0056900.1
Domain Number 1 Region: 117-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-44
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 958-1019
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000191
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0056900.1
Sequence length 1055
Comment pep:novel scaffold:1.0:Oglab06_0029:123837:129516:1 gene:ORGLA06G0056900 transcript:ORGLA06G0056900.1
Sequence
MKDQGSSGVSPAPGEGEKKAINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMHK
ELDNIPGYPSLPSKLICKLLSLTLHADSETDEVYAQMTLQPVNKYDRDAMLASELGLKQN
KQPAEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFTMQPPAQELIAKDLHDISWKFR
HIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIRDEKSQLLLGIRRATRPQPALSSSVL
SSDSMHIGILAAAAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRML
FETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQVGWDESTASERRTRVSIWEIEPVAT
PFYICPPPFFRPKLPKQPGMPDDENEVESAFKRAMPWLADDFALKDVQSSLFPGLSLVQW
MAMQQNPQMLTAASQTVQSPYLNSNALAMQDVMGSSNEDPTKRLNTQAQNMVLPNLQVGS
KVDHPVMSQHQQQPHQLSQQQQVQPSQQSSVVLQQHQAQLLQQNAIHLQQQQEHLQRQQS
QPAQQLKAASSLHSVEQHKLKEQTSGGQVASQAQMLNQIFPPSSSQLQQLGLPKSPTHRQ
GLTGLPIAGSLQQPTLTQTSQVQQAAEYQQALLQSQQQQQQLQLQQLSQPEVQLQLLQKI
QQQNMLSQLNPQHQSQLIQQLSQKSQEILQQQILQHQFGGSDSIGQLKQSPLQQDPLNHM
TGSLTPQQLVRSHSALAESGDPSSSTAPSASRISPINSLSRANQGSRNLTDMVATPQIDN
LLQEIQSKPDNRIKNDIQSKETVPIHNRHPVSDQLDASSATSFCLDESPREGFSFPPVCL
DNNVQVDPRDNFLIAENVDALMPDALLSRGMASGKGMCTLTSGQRDHRDVENELSSAAFS
SQSFGVPDMSFKPGCSSDVAVTDAGMPSQGLWNNQTQRMRTFTKVQKRGSVGRSIDITRY
RDYDELRHDLACMFGIQGQLEDPYRMDWKLVYVDHENDILLVGDDPWEEFVGCVKSIKIL
SAAEVQQMSLDGDLGGVPPQTQACSASDDANAWRG
Download sequence
Identical sequences A0A0D3GDT1 I1Q0A6
ORGLA06G0056900.1 OBART06G06150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]