SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0180700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0180700.1
Domain Number 1 Region: 139-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-17
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 12-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000196
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 315-390
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000275
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0180700.1
Sequence length 390
Comment pep:novel scaffold:1.0:Oglab06_0211:12361:15214:-1 gene:ORGLA06G0180700 transcript:ORGLA06G0180700.1
Sequence
MPLSAGSLRRRPKFAAPLLSPACLHRLSVPGEFAARLDDDDAAGVGEEEEESGRRAAAVL
VVGPLGKVWRVELRRSPAGDGEAWLGGGWSELAAAHGLGEGWGVVLRLERRGVASLRVFD
PGFCLARFCTPHAGMRTKDRPRFIKLLQQEDLEKMKIPEKFVQQQLTETYTNNHQNAIIV
CPLGKFWRVELQREQPDVLLRDGWAPFLAAHDLSEGNILLVRYEGNMVFTVEVFLQNGCL
KEYKTAALYLTDGTEGPSNAPQQSAAKVGVSPVKWKRTRRIEGTCLEGPNRKSRASPISV
KVEQHKKHVSIVSQNSFTKEMTAYSIHSLLSVRGTFCSQIGLLEACAITLKISMKKKGSW
RVAFKTANTYGYINGPGWRKFCLENEVKEG
Download sequence
Identical sequences I1Q3U4
ORGLA06G0180700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]