SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0209500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0209500.1
Domain Number 1 Region: 124-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-28
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0209500.1
Sequence length 698
Comment pep:known scaffold:1.0:Oglab06_0228:29288:32074:1 gene:ORGLA06G0209500 transcript:ORGLA06G0209500.1
Sequence
MITFVDSAAKERERESDKCLDPQLWHACAGGMVQMPPVSSKVYYFPQGHAEHAQGHGPVE
FPGGRVPALVLCRVAGVRFMADPDTDEVFAKIRLVPVRANEQGYAGDADDGIGATAAAAA
QEEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGVVWKF
RHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFMRTENGDLCVGIRRAKKGGVGGPEFL
PPPPPPTPAAGGNYGGFSMFLRGDDDGNKMAAAARGKVRARVRPEEVVEAANLAVSGQPF
EVVYYPRASTPEFCVKAGAVRAAMRTQWFAGMRFKMAFETEDSSRISWFMGTVSAVQVAD
PIRWPNSPWRLLQVSWDEPDLLQNVKRVSPWLVELVSNMPAIHLAPFSPPRKKLCVPLYP
ELPIDGQFPTPMFHGNPLARGVGPMCYFPDGTPAGIQGARHAQFGISLSDLHLNKLQSSL
SPHGLHQLDHGMQPRIAAGLIIGHPAARDDISCLLTIGSPQNNKKSDGKKAPAQLMLFGK
PILTEQQISLGDAASVAVKKSSSDGNAENTVNKSNSDVSSPRSNQNGTTDNLSCGGVPLC
QDNKVLDVGLETGHCKVFMQSEDVGRTLDLSVVGSYEELYRRLADMFGIEKAELMSHVFY
RDAAGALKHTGDEPFSEFTKTARRLNILTDTSGDNLAR
Download sequence
Identical sequences A0A0D3GK33 I1Q4N2
ORGLA06G0209500.1 OBART06G25230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]