SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA06G0221800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA06G0221800.1
Domain Number 1 Region: 142-282
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-43
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 1040-1107
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000451
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA06G0221800.1
Sequence length 1162
Comment pep:novel scaffold:1.0:Oglab06_0229:110190:117541:1 gene:ORGLA06G0221800 transcript:ORGLA06G0221800.1
Sequence
MMKQAQQVPPPPASSAVTTTTAMAAATAAAVVGSGCEGEKTKAPAINSELWHACAGPLVS
LPPAGSLVVYFPQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHNVTLHADPETDEVY
AQMTLQPVTSYGKEALQLSELALKQARPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFP
PLDFSMQPPAQELQARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIFV
RDEKQQLLLGIRRANRQPTNISSSVLSSDSMHIGILAAAAHAAANNSPFTIFYNPRASPT
EFVIPFAKYQKAVYGNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWRN
LQVGWDESAAGERRNRVSIWEIEPVAAPFFICPPPFFGAKRPRQLDDESSEMENLLKRAM
PWLGEEICIKDPQTQNTIMPGLSLVQWMNMNMQQSSSFANTAMQSEYLRSLSNPNMQNLG
AADLSRQLCLQNQLLQQNNIQFNTPKLSQQMQPVNELAKAGIPLNQLAVSTKPQEQIHDA
SNLQRQQPSMNHMLPLSQAQTSLGQAQVLVQNQMQQQHASSTQGQQPATSQPLLMPQQQQ
QQQHQEQQQQQQQQQQQQQKLLQQQQQQLLLQQQQQLSKMPAQLSNLANQQFQLTDQQLQ
LQLLQKLQQQQQSLLSQPAVTLAQLPLIQEQQKLLLDMQQQLSNSQTLSQQQMMPQQSTK
VPSQNTPLPPVQQEPQQKLLQKQAMLADTSEAAVPPTTSVNVISTTGSPLMTTGATHSVL
TEEIPSCSTSPSTANGNHLLQPILGRNKHCSMINTEKVPQSAAPMSVPSSLEAVTAIPRM
IKDSPKLNHNVKQSVVASKLANAGTGSQNYVNNPPPTDYLETASSATSVWLSQNDGLLHQ
NFPMSNFNQPQMFKDAPPDAEIHAANTSNNALFGINGDGPLGFPIGLGTDDFLSNGIDAA
KYENHISTEIDNSYRIPKDAQQEISSSMVSQSFGASDMAFNSIDSTINDGGFLNRSSWPP
AAPLKRMRTFTKVYKRGAVGRSIDMSQFSGYDELKHALARMFSIEGQLEERQRIGWKLVY
KDHEDDILLLGDDPWEEFVGCVKCIRILSPQEVQQMSLEGCDLGNNIPPNQACSSSDGGN
AWRARCDQNSGNPSNGSYEQFE
Download sequence
Identical sequences I1Q505
ORGLA06G0221800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]