SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0067400.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0067400.1
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000196
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0067400.1
Sequence length 202
Comment pep:novel scaffold:1.0:Oglab07_0045:63014:63948:-1 gene:ORGLA07G0067400 transcript:ORGLA07G0067400.1
Sequence
MVKIKTASQDYLPIPVAVTKASRLKHGRTLKLMTAHGLKIRVKVAEARDKLYMTIGWKEF
IQETGLKMGESRSVVFRTLSKSRLNVIIFNKEGYSRCPIPDKAAKALINNQSSSAPSFST
KSTAPRHPSSTNVEANTKRIVKDMCCYNKRMKLSSEVKNYVRDIAQFLDYSSKFYIVTIK
NIHEVRQGGKIFHLLSIYSLEK
Download sequence
Identical sequences I1Q982
ORGLA07G0067400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]