SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA08G0079700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORGLA08G0079700.1
Domain Number - Region: 228-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00369
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA08G0079700.1
Sequence length 327
Comment pep:novel scaffold:1.0:Oglab08_0054:31883:32866:1 gene:ORGLA08G0079700 transcript:ORGLA08G0079700.1
Sequence
MAPAGGNGNGNSHRVVGRKRLLVAGGAGEEDRLRGKKRAAAGALVPYVAAASASAPIDAV
PLAAVAPASSSSLAAGEVPNEPSWIRKIVFYRLGLPYDLPLVFIEEKTVTRTDLDSHQNR
FRLACGGVGRSLIPMLTRREAIAASFLRKEEDEAQAAGLTPPQPEENNTAVVVEQQEEEE
EEEAAVTTPPQPESDTAVAVAEQQQQQEEEETAGPGGRKKKKKKGRSHGGLPVTLVHLRG
GMKRLLLTRWDSSGAAIIKGEGYLDFIARCGIKEKDVVHVWAFKQQGFRLFGATYPPGPL
YILIAGTARLAAPPPPQPPVAQSPPSC
Download sequence
Identical sequences I1QH96
ORGLA08G0079700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]