SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA08G0091200.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA08G0091200.1
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-21
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA08G0091200.1
Sequence length 270
Comment pep:known scaffold:1.0:Oglab08_0060:834639:836310:1 gene:ORGLA08G0091200 transcript:ORGLA08G0091200.1
Sequence
MGTSCERCRRRDEQDYRNLDDSQKHFLLTMMGDFQHEMIIPKEFVQRLKGDIPGEIQLET
RNRNSHTVRVDKTQEKVIFTEGWAQFVKTFDLQMGDSMMFRFNGNSQFDVIIVDQIGREK
ACSAVVDDSQNPNVQERRVDATETLNSSRAHSQPMPMQSTTETVNHSHARPCPMHTAVDC
MPLSHAHPQPMPMQFPTETVNHCHAPTGPMEMPLENVALSHAHARPLQMQSQPTDRLTQV
QRGNSSKGNMTTMSSSSMSSGYNSIIICIS
Download sequence
Identical sequences I1QHL1 Q6Z0D9
39947.LOC_Os08g23470.1 LOC_Os08g23470.1|13108.m02404|protein LOC_Os08g23470.1|PACid:21890052 ORGLA08G0091200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]